PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016432344.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 577aa    MW: 66545.6 Da    PI: 7.1912
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016432344.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.11.9e-141694999
                    HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k++ l +pk f+ ++ +g ++e     +  +  + W vk+  +     y +++GW eFv++n+L+ gD++vF+++g++ef   v++f++
  XP_016432344.1 16 PGFKHA-LKIPKGFL-KYlKGHEHE---HAVLRRVDKYWLVKV--ND----YRFKAGWAEFVEENDLQLGDMLVFRYEGNMEF--EVMIFDS 94
                    456666.********.554666544...56667789*******..55....55**************************9999..8999886 PP

2B351.42e-16194275590
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     +++++ l+ g ++lp +fa+    ++ ++ +l+++de+ r W++kl+ + + +r+ +++GW++F  +n+LkegD +vF+++ ++e+
  XP_016432344.1 194 TIKPYCLTYGYMYLPQQFANGL--SN-KKCDLIIRDERQRLWNLKLS-SDCNNRVRIGDGWRKFIVDNRLKEGDHIVFEVVTDEET 275
                     578999999*********9444..43.3348***************5.66667799***********************8876544 PP

3B346.66.2e-15349430590
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     +++++ l+ g l+l  +fa+    ++ ++ +l+++de+ r W++kl+ + +++r+ +++GW +F  +n+LkegD +vF+++ ++e+
  XP_016432344.1 349 TIKPYCLTYGYLYLAQQFANGL--SN-KKCDLIIRDERQRLWNLKLS-SDYKNRVRIGDGWCKFIADNRLKEGDRIVFEVVTDEET 430
                     578899999*********9444..43.3348***************5.777889*************************8876554 PP

4B353.35.2e-17483570595
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     +++ ++ +++r+ +pk fa+e+g+++++  t+ ++d++ rs e++l y+ + g++++++ W++F+ an LkegD ++F+    +++++ +k
  XP_016432344.1 483 TVKLHHISKCRMHVPKLFARENGLSNRK-CTIAIRDSEQRSLEFRL-YSSSAGSTFIGGEWRKFCAANFLKEGDCIMFEIFA-KGEKPILK 570
                     4578999***************999765.5****************.9999999*************************544.66666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.8E-21497IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.26E-20797IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.647795IPR003340B3 DNA binding domain
CDDcd100171.54E-15893No hitNo description
SMARTSM010191.8E-131095IPR003340B3 DNA binding domain
PfamPF023628.9E-111994IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.9E-18188280IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.32E-18188280IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.084190286IPR003340B3 DNA binding domain
SMARTSM010193.1E-13191283IPR003340B3 DNA binding domain
PfamPF023628.5E-15194275IPR003340B3 DNA binding domain
CDDcd100179.96E-14195268No hitNo description
Gene3DG3DSA:2.40.330.106.0E-16343435IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.46E-15343435IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.632345441IPR003340B3 DNA binding domain
SMARTSM010191.1E-7346438IPR003340B3 DNA binding domain
PfamPF023621.8E-12349430IPR003340B3 DNA binding domain
CDDcd100178.29E-10350423No hitNo description
Gene3DG3DSA:2.40.330.105.7E-16476569IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-16479571IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.334479574IPR003340B3 DNA binding domain
SMARTSM010191.4E-9480575IPR003340B3 DNA binding domain
PfamPF023622.9E-15483571IPR003340B3 DNA binding domain
CDDcd100173.00E-14487572No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MKVRPVKPQF FKPILPGFKH ALKIPKGFLK YLKGHEHEHA VLRRVDKYWL VKVNDYRFKA  60
GWAEFVEEND LQLGDMLVFR YEGNMEFEVM IFDSSHCNRE YAEYLQEEEA AATHTFGEAS  120
KNFEFEDTNN YASIPSGDRL YQSSPSTSCY LSHSRNTDDV IEIPSPGIKL SDEDSSRAEA  180
ATDKHVGHSH FVCTIKPYCL TYGYMYLPQQ FANGLSNKKC DLIIRDERQR LWNLKLSSDC  240
NNRVRIGDGW RKFIVDNRLK EGDHIVFEVV TDEETSIWKF HVVTTAETPM RKFQGGHGFE  300
AWKQPLAEIP SPDDVIEIPS PCIKSSDEDF SHAEAATDKH VGHSHFVCTI KPYCLTYGYL  360
YLAQQFANGL SNKKCDLIIR DERQRLWNLK LSSDYKNRVR IGDGWCKFIA DNRLKEGDRI  420
VFEVVTDEET SIWKFHAVTN AETPMRKFQE KPEPNIMSSY KAFPDVEAAK DMPLSRPDHF  480
ISTVKLHHIS KCRMHVPKLF ARENGLSNRK CTIAIRDSEQ RSLEFRLYSS SAGSTFIGGE  540
WRKFCAANFL KEGDCIMFEI FAKGEKPILK FYGLGIG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016432344.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X3
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.14e-37B3 family protein